PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G13620.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 25745.7 Da    PI: 9.4575
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G13620.5genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF1008.9e-323383151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  OMERI06G13620.5 33 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 83
                     79***********************************************96 PP

2K-box77.24.2e-268315033100
            K-box  33 reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      ++qR+llGedL+sL +keL++Le+qL++slk++R++++++l++q+ elq+ke++++e+n++Lr+klee
  OMERI06G13620.5  83 STQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEE 150
                      689**************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-412584IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.3892585IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.98E-302686IPR002100Transcription factor, MADS-box
CDDcd002651.29E-402684No hitNo description
PRINTSPR004047.1E-332747IPR002100Transcription factor, MADS-box
PROSITE patternPS0035002781IPR002100Transcription factor, MADS-box
PfamPF003191.9E-263481IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-334762IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-336283IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.1664154IPR002487Transcription factor, K-box
PfamPF014865.1E-2083148IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGEKKKKKKL QLLFLPFSCW RSIGMGRGRV ELKRIENKIN RQVTFAKRRN GLLKKAYELS  60
VLCDAEVALI IFSNRGKLYE FCSTQRNLLG EDLDSLGIKE LESLEKQLDS SLKHVRTTRT  120
KHLVDQLTEL QRKEQMVSEA NRCLRRKLEE SNHVRGQQVW EQGCNLIAYE RQPEVQQPLH  180
GGNGFFHPLD AAGEPTLQIG YPAEHHEAMN SACMNTYMPP WLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D1e-198414837101Developmental protein SEPALLATA 3
4ox0_C1e-198414837101Developmental protein SEPALLATA 3
4ox0_B1e-198414837101Developmental protein SEPALLATA 3
4ox0_A1e-198414837101Developmental protein SEPALLATA 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
129EKKKKKKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1002630.0AK100263.1 Oryza sativa Japonica Group cDNA clone:J023063L04, full insert sequence.
GenBankAY5519210.0AY551921.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS216 mRNA, complete cds.
GenBankFJ7509340.0FJ750934.1 Oryza sativa clone KCS054B01 MADS-box transcription factor 7 mRNA, complete cds.
GenBankOSU319940.0U31994.1 Oryza sativa MADS box protein OsMADS45 mRNA, complete cds.
GenBankOSU788910.0U78891.2 Oryza sativa MADS box protein (MADS7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648762.11e-138PREDICTED: MADS-box transcription factor 7 isoform X2
SwissprotP0C5B01e-140MADS7_ORYSI; MADS-box transcription factor 7
SwissprotQ0J4661e-140MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBLA0A0E0E0X01e-167A0A0E0E0X0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA029052-PA1e-138(Oryza sativa Indica Group)
STRINGORGLA08G0230000.11e-138(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.14e-64MIKC_MADS family protein